Class a: All alpha proteins [46456] (289 folds) |
Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) automatically mapped to Pfam PF02742 |
Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
Protein Iron-dependent regulator [47983] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries) Uniprot Q50495 |
Domain d2iszb2: 2isz B:65-140 [137619] Other proteins in same PDB: d2isza1, d2iszb1, d2iszc1, d2iszd1 automated match to d2iszb2 protein/DNA complex; complexed with na, ni |
PDB Entry: 2isz (more details), 2.4 Å
SCOPe Domain Sequences for d2iszb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iszb2 a.76.1.1 (B:65-140) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]} tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt tspfgnpipglvelgv
Timeline for d2iszb2: