Lineage for d2isza2 (2isz A:65-140)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644361Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 644362Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
  5. 644363Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)
  6. 644396Protein Iron-dependent regulator [47983] (1 species)
  7. 644397Species Mycobacterium tuberculosis [TaxId:1773] [47984] (6 PDB entries)
  8. 644404Domain d2isza2: 2isz A:65-140 [137617]
    Other proteins in same PDB: d2isza1, d2iszb1, d2iszc1, d2iszd1
    automatically matched to d1b1ba2
    complexed with na, ni

Details for d2isza2

PDB Entry: 2isz (more details), 2.4 Å

PDB Description: crystal structure of a two-domain ider-dna complex crystal form i
PDB Compounds: (A:) iron-dependent repressor ider

SCOP Domain Sequences for d2isza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2isza2 a.76.1.1 (A:65-140) Iron-dependent regulator {Mycobacterium tuberculosis [TaxId: 1773]}
tekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvlnnpt
tspfgnpipglvelgv

SCOP Domain Coordinates for d2isza2:

Click to download the PDB-style file with coordinates for d2isza2.
(The format of our PDB-style files is described here.)

Timeline for d2isza2: