SCOP 1.73: Domain d2isyb1: 2isy B:2-64

Lineage for d2isyb1 (2isy B:2-64)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins)

6. Protein Iron-dependent regulator IdeR [46885] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries)

8. Domain d2isyb1: 2isy B:2-64 [137614]
   Other proteins in same PDB: d2isya2, d2isyb2
   automatically matched to d1b1ba1
   complexed with ni, po4

Details for d2isyb1

PDB Entry: 2isy, 1.96 Å

PDB Description: crystal structure of the nickel-activated two-domain iron-dependent regulator (ider)

PDB Compounds: (B:) iron-dependent repressor ider

SCOP Domain Sequences for d2isyb1:

Sequence; same for both SEQRES and ATOM records:

>d2isyb1 a.4.5.24 (B:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]}
nelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdrh
lel

Timeline for d2isyb1:

• d2isyb1 is new in SCOP 1.73
  
• d2isyb1 appears in SCOP 1.75
  
• d2isyb1 appears in the current release, SCOPe 2.08