![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins) |
![]() | Protein Iron-dependent regulator IdeR [46885] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries) |
![]() | Domain d2isyb1: 2isy B:2-64 [137614] Other proteins in same PDB: d2isya2, d2isyb2 automatically matched to d1b1ba1 complexed with ni, po4 |
PDB Entry: 2isy (more details), 1.96 Å
SCOP Domain Sequences for d2isyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2isyb1 a.4.5.24 (B:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} nelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdrh lel
Timeline for d2isyb1: