Lineage for d2isya1 (2isy A:2-64)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306994Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. 2307030Protein Iron-dependent regulator IdeR [46885] (1 species)
  7. 2307031Species Mycobacterium tuberculosis [TaxId:1773] [46886] (6 PDB entries)
    Uniprot Q50495
  8. 2307032Domain d2isya1: 2isy A:2-64 [137612]
    Other proteins in same PDB: d2isya2, d2isya3, d2isyb2, d2isyb3
    automated match to d1fx7a1
    complexed with ni, po4

Details for d2isya1

PDB Entry: 2isy (more details), 1.96 Å

PDB Description: crystal structure of the nickel-activated two-domain iron-dependent regulator (ider)
PDB Compounds: (A:) iron-dependent repressor ider

SCOPe Domain Sequences for d2isya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]}
nelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdrh
lel

SCOPe Domain Coordinates for d2isya1:

Click to download the PDB-style file with coordinates for d2isya1.
(The format of our PDB-style files is described here.)

Timeline for d2isya1: