Lineage for d2ispa3 (2isp A:149-335)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [81574] (145 PDB entries)
    Uniprot P06746
  8. Domain d2ispa3: 2isp A:149-335 [137611]
    Other proteins in same PDB: d2ispa1, d2ispa2
    automated match to d1tv9a3
    protein/DNA complex; complexed with cl, ggh, mg, na

Details for d2ispa3

PDB Entry: 2isp (more details), 2.2 Å

PDB Description: Ternary complex of DNA Polymerase beta with a dideoxy terminated primer and 2'-deoxyguanosine 5'-beta, gamma-methylene triphosphate
PDB Compounds: (A:) Polymerase (DNA directed), beta

SCOPe Domain Sequences for d2ispa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ispa3 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

SCOPe Domain Coordinates for d2ispa3 are not available.

Timeline for d2ispa3:

Domains from same chain:
(mouse over for more information)
d2ispa1, d2ispa2