Lineage for d2isia_ (2isi A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224399Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2224400Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2224401Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2224457Protein automated matches [190454] (2 species)
    not a true protein
  7. 2224458Species Human (Homo sapiens) [TaxId:9606] [187368] (6 PDB entries)
  8. 2224467Domain d2isia_: 2isi A: [137603]
    automated match to d2o3ha_
    complexed with mg, po4

Details for d2isia_

PDB Entry: 2isi (more details), 2.76 Å

PDB Description: Crystal structure of Ape1 from Homo sapiens in a new crystal form complexed with a ligand
PDB Compounds: (A:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d2isia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2isia_ d.151.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
dyfllshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d2isia_:

Click to download the PDB-style file with coordinates for d2isia_.
(The format of our PDB-style files is described here.)

Timeline for d2isia_: