SCOPe 2.05: Domain d2isia_: 2isi A:

Lineage for d2isia_ (2isi A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.1: DNase I-like [56220] (7 proteins)

6. Protein automated matches [190454] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187368] (6 PDB entries)

8. Domain d2isia_: 2isi A: [137603]
   automated match to d2o3ha_
   complexed with mg, po4

Details for d2isia_

PDB Entry: 2isi, 2.76 Å

PDB Description: Crystal structure of Ape1 from Homo sapiens in a new crystal form complexed with a ligand

PDB Compounds: (A:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d2isia_:

Sequence; same for both SEQRES and ATOM records:

>d2isia_ d.151.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
dyfllshsllpalcdskirskalgsdhcpitlylal

Timeline for d2isia_:

• d2isia_ first appeared in SCOP 1.73, called d2isia1
  
• d2isia_ appears in SCOPe 2.04
  
• d2isia_ appears in SCOPe 2.06
  
• d2isia_ appears in the current release, SCOPe 2.08