Lineage for d2isia1 (2isi A:43-318)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044453Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 1044454Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 1044455Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 1044477Protein DNA repair endonuclease Hap1 [56223] (1 species)
    Major apurinic/apyrimidinic endonuclease APE1
  7. 1044478Species Human (Homo sapiens) [TaxId:9606] [56224] (7 PDB entries)
  8. 1044487Domain d2isia1: 2isi A:43-318 [137603]
    automatically matched to d1e9na_
    complexed with mg, po4

Details for d2isia1

PDB Entry: 2isi (more details), 2.76 Å

PDB Description: Crystal structure of Ape1 from Homo sapiens in a new crystal form complexed with a ligand
PDB Compounds: (A:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d2isia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2isia1 d.151.1.1 (A:43-318) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
alyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsen
klpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaef
dsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrn
pkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrl
dyfllshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d2isia1:

Click to download the PDB-style file with coordinates for d2isia1.
(The format of our PDB-style files is described here.)

Timeline for d2isia1: