![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.9: FumA C-terminal domain-like [117457] (1 family) ![]() automatically mapped to Pfam PF05683 |
![]() | Family c.8.9.1: FumA C-terminal domain-like [117458] (1 protein) Pfam PF05683 |
![]() | Protein Fumarate hydratase class I beta subunit [117459] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [117460] (1 PDB entry) Uniprot O29167 # AF1098 |
![]() | Domain d2isba_: 2isb A: [137601] automated match to d1vpja_ |
PDB Entry: 2isb (more details), 1.66 Å
SCOPe Domain Sequences for d2isba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2isba_ c.8.9.1 (A:) Fumarate hydratase class I beta subunit {Archaeoglobus fulgidus [TaxId: 2234]} hhhhmvmeyelrtplvkdqilklkvgdvvyitgeiftardeaharalewmeegkelpfsf dkgvvyhcgplvkkndewrvvsagpttsarmnpftpkilekvecmgiigkggmseevvea mrgkaayfaftggagalaamsikkvkgvvwedlgmpeavwlleverfgpcivaidahgns lyrr
Timeline for d2isba_: