| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
| Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
| Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [117424] (4 PDB entries) |
| Domain d2irwb1: 2irw B:26-289 [137594] automatically matched to d1xu9b_ complexed with nap, nn4 |
PDB Entry: 2irw (more details), 3.1 Å
SCOP Domain Sequences for d2irwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2irwb1 c.2.1.2 (B:26-289) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt
llirnpsrkileflystsynmdrf
Timeline for d2irwb1: