Lineage for d2irwb1 (2irw B:26-289)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 686319Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 686323Species Human (Homo sapiens) [TaxId:9606] [117424] (4 PDB entries)
  8. 686337Domain d2irwb1: 2irw B:26-289 [137594]
    automatically matched to d1xu9b_
    complexed with nap, nn4

Details for d2irwb1

PDB Entry: 2irw (more details), 3.1 Å

PDB Description: human 11-beta-hydroxysteroid dehydrogenase (hsd1) with nadp and adamantane ether inhibitor
PDB Compounds: (B:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOP Domain Sequences for d2irwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2irwb1 c.2.1.2 (B:26-289) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
syvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvsr
vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwtt
llirnpsrkileflystsynmdrf

SCOP Domain Coordinates for d2irwb1:

Click to download the PDB-style file with coordinates for d2irwb1.
(The format of our PDB-style files is described here.)

Timeline for d2irwb1: