SCOP 1.73: Domain d2irvb1: 2irv B:93-271

Lineage for d2irvb1 (2irv B:93-271)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.51: Rhomboid-like [144090] (1 superfamily)
   6 transmembrane helices

4. Superfamily f.51.1: Rhomboid-like [144091] (1 family)

5. Family f.51.1.1: Rhomboid-like [144092] (2 proteins)
   Pfam PF01694; transmembrane serine protease

6. Protein GlpG [144095] (1 species)

7. Species Escherichia coli [TaxId:562] [144096] (4 PDB entries)

8. Domain d2irvb1: 2irv B:93-271 [137592]
   automatically matched to 2IC8 A:91-272
   complexed with lda, lmt, pgv, po4

Details for d2irvb1

PDB Entry: 2irv, 2.3 Å

PDB Description: Crystal structure of GlpG, a rhomboid intramembrane serine protease

PDB Compounds: (B:) Protein glpG

SCOP Domain Sequences for d2irvb1:

Sequence; same for both SEQRES and ATOM records:

>d2irvb1 f.51.1.1 (B:93-271) GlpG {Escherichia coli [TaxId: 562]}
agpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmhil
fnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgyvw
lrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdsln

Timeline for d2irvb1:

• d2irvb1 is new in SCOP 1.73
  
• d2irvb1 appears in SCOP 1.75
  
• d2irvb1 appears in the current release, SCOPe 2.08, called d2irvb_