Lineage for d2irvb1 (2irv B:93-271)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746737Fold f.51: Rhomboid-like [144090] (1 superfamily)
    6 transmembrane helices
  4. 746738Superfamily f.51.1: Rhomboid-like [144091] (1 family) (S)
  5. 746739Family f.51.1.1: Rhomboid-like [144092] (2 proteins)
    Pfam PF01694; transmembrane serine protease
  6. 746740Protein GlpG [144095] (1 species)
  7. 746741Species Escherichia coli [TaxId:562] [144096] (4 PDB entries)
  8. 746744Domain d2irvb1: 2irv B:93-271 [137592]
    automatically matched to 2IC8 A:91-272
    complexed with lda, lmt, pgv, po4

Details for d2irvb1

PDB Entry: 2irv (more details), 2.3 Å

PDB Description: Crystal structure of GlpG, a rhomboid intramembrane serine protease
PDB Compounds: (B:) Protein glpG

SCOP Domain Sequences for d2irvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2irvb1 f.51.1.1 (B:93-271) GlpG {Escherichia coli [TaxId: 562]}
agpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmhil
fnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgyvw
lrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdsln

SCOP Domain Coordinates for d2irvb1:

Click to download the PDB-style file with coordinates for d2irvb1.
(The format of our PDB-style files is described here.)

Timeline for d2irvb1: