SCOPe 2.08: Domain d2irvb_: 2irv B:

Lineage for d2irvb_ (2irv B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.51: Rhomboid-like [144090] (1 superfamily)
   6 transmembrane helices

4. Superfamily f.51.1: Rhomboid-like [144091] (2 families)

5. Family f.51.1.1: Rhomboid-like [144092] (3 proteins)
   Pfam PF01694; transmembrane serine protease

6. Protein GlpG [144095] (1 species)

7. Species Escherichia coli [TaxId:562] [144096] (19 PDB entries)
   Uniprot P09391 91-272

8. Domain d2irvb_: 2irv B: [137592]
   automated match to d2ic8a1
   complexed with lda, lmt, pgv, po4

Details for d2irvb_

PDB Entry: 2irv, 2.3 Å

PDB Description: Crystal structure of GlpG, a rhomboid intramembrane serine protease

PDB Compounds: (B:) Protein glpG

SCOPe Domain Sequences for d2irvb_:

Sequence; same for both SEQRES and ATOM records:

>d2irvb_ f.51.1.1 (B:) GlpG {Escherichia coli [TaxId: 562]}
agpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmhil
fnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgyvw
lrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdsln

Timeline for d2irvb_:

• d2irvb_ first appeared in SCOP 1.73, called d2irvb1
  
• d2irvb_ appears in SCOPe 2.07