Lineage for d2iqqa1 (2iqq A:14-158)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 866361Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 866916Superfamily d.81.2: Serine metabolism enzymes domain [143548] (2 families) (S)
    contains extra C-terminal beta-hairpin
  5. 866917Family d.81.2.1: Serine dehydratase beta chain-like [143549] (1 protein)
    Pfam PF03315
  6. 866918Protein L-serine dehydratase SdhL, N-terminal domain [143550] (1 species)
  7. 866919Species Legionella pneumophila [TaxId:446] [143551] (2 PDB entries)
    Uniprot Q5ZXE1 17-161
  8. 866921Domain d2iqqa1: 2iqq A:14-158 [137589]
    complexed with mg

Details for d2iqqa1

PDB Entry: 2iqq (more details), 2.66 Å

PDB Description: the crystal structure of iron, sulfur-dependent l-serine dehydratase from legionella pneumophila subsp. pneumophila
PDB Compounds: (A:) Iron, Sulfur-Dependent L-serine dehydratase

SCOP Domain Sequences for d2iqqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iqqa1 d.81.2.1 (A:14-158) L-serine dehydratase SdhL, N-terminal domain {Legionella pneumophila [TaxId: 446]}
sshtvgpmlaanaflqlleqknlfdktqrvkvelygslaltgkghgtdkailnglenkap
etvdpasmiprmheildsnllnlagkkeipfheatdflflqkellpkhsngmrfsafdgn
anllieqvyysigggfitteedfdk

SCOP Domain Coordinates for d2iqqa1:

Click to download the PDB-style file with coordinates for d2iqqa1.
(The format of our PDB-style files is described here.)

Timeline for d2iqqa1: