Lineage for d2iqda_ (2iqd A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2092401Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2092402Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2092464Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 2092465Species Human (Homo sapiens) [TaxId:9606] [51437] (135 PDB entries)
    Uniprot P15121
  8. 2092574Domain d2iqda_: 2iqd A: [137587]
    automated match to d1ads__
    complexed with lpa, nap

Details for d2iqda_

PDB Entry: 2iqd (more details), 2 Å

PDB Description: crystal structure of aldose reductase complexed with lipoic acid
PDB Compounds: (A:) aldose reductase

SCOPe Domain Sequences for d2iqda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iqda_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
asrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqe
klreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgke
ffpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpa
vnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakh
nkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvcal
lsctshkdypfheef

SCOPe Domain Coordinates for d2iqda_:

Click to download the PDB-style file with coordinates for d2iqda_.
(The format of our PDB-style files is described here.)

Timeline for d2iqda_: