Lineage for d2ipra_ (2ipr A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917084Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 1917085Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 1917086Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)
  6. 1917087Protein The origin DNA-binding domain of SV40 T-antigen [55466] (2 species)
  7. 1917094Species Simian virus 40, Sv40 [TaxId:10633] [55467] (11 PDB entries)
  8. 1917096Domain d2ipra_: 2ipr A: [137583]
    automated match to d1tbd__

Details for d2ipra_

PDB Entry: 2ipr (more details), 1.5 Å

PDB Description: Origin binding domain of the SV40 large T antigen (residues 131-259). P21 crystal form
PDB Compounds: (A:) large t antigen

SCOPe Domain Sequences for d2ipra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ipra_ d.89.1.1 (A:) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
vedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsyn
hnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpgg
lkehdfn

SCOPe Domain Coordinates for d2ipra_:

Click to download the PDB-style file with coordinates for d2ipra_.
(The format of our PDB-style files is described here.)

Timeline for d2ipra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2iprb_