Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries) Uniprot P23313 |
Domain d2ipkd2: 2ipk D:122-239 [137582] Other proteins in same PDB: d2ipka1, d2ipka2, d2ipkb1, d2ipkb2, d2ipkd1 automatically matched to d1jwmd2 |
PDB Entry: 2ipk (more details), 2.3 Å
SCOPe Domain Sequences for d2ipkd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ipkd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]} hfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy etgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng
Timeline for d2ipkd2:
View in 3D Domains from other chains: (mouse over for more information) d2ipka1, d2ipka2, d2ipkb1, d2ipkb2 |