Lineage for d2ipkd1 (2ipk D:1-121)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1314261Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1314320Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 1314321Species Staphylococcus aureus [TaxId:1280] [50229] (11 PDB entries)
    Uniprot P23313
  8. 1314324Domain d2ipkd1: 2ipk D:1-121 [137581]
    Other proteins in same PDB: d2ipka1, d2ipka2, d2ipkb1, d2ipkb2, d2ipkd2
    automatically matched to d1jwmd1

Details for d2ipkd1

PDB Entry: 2ipk (more details), 2.3 Å

PDB Description: crystal structure of the mhc class ii molecule hla-dr1 in complex with the fluorogenic peptide, acpkxvkqntlklat (x=3-[5-(dimethylamino)-1,3- dioxo-1,3-dihydro-2h-isoindol-2-yl]-l-alanine) and the superantigen, sec3 variant 3b2
PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d2ipkd1:

Sequence, based on SEQRES records: (download)

>d2ipkd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records): (download)

>d2ipkd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskggktcmyggitkhegn

SCOPe Domain Coordinates for d2ipkd1:

Click to download the PDB-style file with coordinates for d2ipkd1.
(The format of our PDB-style files is described here.)

Timeline for d2ipkd1: