SCOPe 2.02: Domain d2ipkd1: 2ipk D:1-121

Lineage for d2ipkd1 (2ipk D:1-121)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50229] (11 PDB entries)
   Uniprot P23313

8. Domain d2ipkd1: 2ipk D:1-121 [137581]
   Other proteins in same PDB: d2ipka1, d2ipka2, d2ipkb1, d2ipkb2, d2ipkd2
   automatically matched to d1jwmd1

Details for d2ipkd1

PDB Entry: 2ipk, 2.3 Å

PDB Description: crystal structure of the mhc class ii molecule hla-dr1 in complex with the fluorogenic peptide, acpkxvkqntlklat (x=3-[5-(dimethylamino)-1,3- dioxo-1,3-dihydro-2h-isoindol-2-yl]-l-alanine) and the superantigen, sec3 variant 3b2

PDB Compounds: (D:) Enterotoxin type C-3

SCOPe Domain Sequences for d2ipkd1:

Sequence, based on SEQRES records:

>d2ipkd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
n

Sequence, based on observed residues (ATOM records):

>d2ipkd1 b.40.2.2 (D:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdsffkwdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskggktcmyggitkhegn

Timeline for d2ipkd1:

• d2ipkd1 first appeared in SCOP 1.73
  
• d2ipkd1 appears in SCOPe 2.01
  
• d2ipkd1 appears in SCOPe 2.03
  
• d2ipkd1 appears in the current release, SCOPe 2.08