Lineage for d2ipkb2 (2ipk B:1-92)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183369Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2183433Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (9 PDB entries)
  8. 2183437Domain d2ipkb2: 2ipk B:1-92 [137580]
    Other proteins in same PDB: d2ipka1, d2ipka2, d2ipkb1, d2ipkd1, d2ipkd2
    automatically matched to d1d5xb2

Details for d2ipkb2

PDB Entry: 2ipk (more details), 2.3 Å

PDB Description: crystal structure of the mhc class ii molecule hla-dr1 in complex with the fluorogenic peptide, acpkxvkqntlklat (x=3-[5-(dimethylamino)-1,3- dioxo-1,3-dihydro-2h-isoindol-2-yl]-l-alanine) and the superantigen, sec3 variant 3b2
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2ipkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ipkb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d2ipkb2:

Click to download the PDB-style file with coordinates for d2ipkb2.
(The format of our PDB-style files is described here.)

Timeline for d2ipkb2: