Lineage for d2ipka1 (2ipk A:83-179)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026687Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 2026753Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (27 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2026757Domain d2ipka1: 2ipk A:83-179 [137577]
    Other proteins in same PDB: d2ipka2, d2ipkb1, d2ipkb2, d2ipkd1, d2ipkd2
    automatically matched to d1k2da1

Details for d2ipka1

PDB Entry: 2ipk (more details), 2.3 Å

PDB Description: crystal structure of the mhc class ii molecule hla-dr1 in complex with the fluorogenic peptide, acpkxvkqntlklat (x=3-[5-(dimethylamino)-1,3- dioxo-1,3-dihydro-2h-isoindol-2-yl]-l-alanine) and the superantigen, sec3 variant 3b2
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2ipka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ipka1 b.1.1.2 (A:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwe

SCOPe Domain Coordinates for d2ipka1:

Click to download the PDB-style file with coordinates for d2ipka1.
(The format of our PDB-style files is described here.)

Timeline for d2ipka1: