![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
![]() | Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (27 PDB entries) probably orthologous to the human HLA-DQ group |
![]() | Domain d2ipka1: 2ipk A:83-179 [137577] Other proteins in same PDB: d2ipka2, d2ipkb1, d2ipkb2, d2ipkd1, d2ipkd2 automatically matched to d1k2da1 |
PDB Entry: 2ipk (more details), 2.3 Å
SCOPe Domain Sequences for d2ipka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ipka1 b.1.1.2 (A:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred hlfrkfhylpflpstedvydcrvehwgldepllkhwe
Timeline for d2ipka1:
![]() Domains from other chains: (mouse over for more information) d2ipkb1, d2ipkb2, d2ipkd1, d2ipkd2 |