Lineage for d2iosa_ (2ios A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2338934Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 2338971Protein Programmed cell death 4, PDCD4 [140815] (1 species)
  7. 2338972Species Mouse (Mus musculus) [TaxId:10090] [140816] (5 PDB entries)
    Uniprot Q61823 322-448! Uniprot Q61823 322-450
  8. 2338974Domain d2iosa_: 2ios A: [137576]
    automated match to d2iona1

Details for d2iosa_

PDB Entry: 2ios (more details), 1.76 Å

PDB Description: Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form 3
PDB Compounds: (A:) Programmed Cell Death 4, Pdcd4

SCOPe Domain Sequences for d2iosa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iosa_ a.118.1.14 (A:) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]}
pvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesafkm
ildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagiiskq
lrdlcp

SCOPe Domain Coordinates for d2iosa_:

Click to download the PDB-style file with coordinates for d2iosa_.
(The format of our PDB-style files is described here.)

Timeline for d2iosa_: