SCOP 1.75: Domain d2iosa1: 2ios A:323-448

Lineage for d2iosa1 (2ios A:323-448)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (23 families)

5. Family a.118.1.14: MIF4G domain-like [100908] (5 proteins)
   duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
   this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain

6. Protein Programmed cell death 4, PDCD4 [140815] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140816] (4 PDB entries)
   Uniprot Q61823 322-448! Uniprot Q61823 322-450

8. Domain d2iosa1: 2ios A:323-448 [137576]
   automatically matched to 2IOL A:322-448

Details for d2iosa1

PDB Entry: 2ios, 1.76 Å

PDB Description: Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form 3

PDB Compounds: (A:) Programmed Cell Death 4, Pdcd4

SCOP Domain Sequences for d2iosa1:

Sequence; same for both SEQRES and ATOM records:

>d2iosa1 a.118.1.14 (A:323-448) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]}
pvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesafkm
ildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagiiskq
lrdlcp

Timeline for d2iosa1:

• d2iosa1 first appeared in SCOP 1.73
  
• d2iosa1 is called d2iosa_ in SCOPe 2.01
  
• d2iosa1 appears in the current release, SCOPe 2.08, called d2iosa_