SCOPe 2.08: Domain d2iosa_: 2ios A:

Lineage for d2iosa_ (2ios A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
   duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
   this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain

6. Protein Programmed cell death 4, PDCD4 [140815] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140816] (5 PDB entries)
   Uniprot Q61823 322-448! Uniprot Q61823 322-450

8. Domain d2iosa_: 2ios A: [137576]
   automated match to d2iona1
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d2iosa_

PDB Entry: 2ios, 1.76 Å

PDB Description: Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form 3

PDB Compounds: (A:) Programmed Cell Death 4, Pdcd4

SCOPe Domain Sequences for d2iosa_:

Sequence; same for both SEQRES and ATOM records:

>d2iosa_ a.118.1.14 (A:) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]}
pvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesafkm
ildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagiiskq
lrdlcp

Timeline for d2iosa_:

• d2iosa_ first appeared in SCOP 1.73, called d2iosa1
  
• d2iosa_ appears in SCOPe 2.07