SCOPe 2.07: Domain d2iolb_: 2iol B:

Lineage for d2iolb_ (2iol B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (27 families)

5. Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
   duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
   this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain

6. Protein Programmed cell death 4, PDCD4 [140815] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140816] (5 PDB entries)
   Uniprot Q61823 322-448! Uniprot Q61823 322-450

8. Domain d2iolb_: 2iol B: [137574]
   automated match to d2iona1

Details for d2iolb_

PDB Entry: 2iol, 2 Å

PDB Description: Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form 1

PDB Compounds: (B:) Programmed Cell Death 4, Pdcd4

SCOPe Domain Sequences for d2iolb_:

Sequence; same for both SEQRES and ATOM records:

>d2iolb_ a.118.1.14 (B:) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]}
qpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesafk
mildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagiisk
qlrdlcp

Timeline for d2iolb_:

• d2iolb_ first appeared in SCOP 1.73, called d2iolb1
  
• d2iolb_ appears in SCOPe 2.06
  
• d2iolb_ appears in the current release, SCOPe 2.08