![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (26 families) ![]() |
![]() | Family a.118.1.14: MIF4G domain-like [100908] (6 proteins) duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain |
![]() | Protein Programmed cell death 4, PDCD4 [140815] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [140816] (5 PDB entries) Uniprot Q61823 322-448! Uniprot Q61823 322-450 |
![]() | Domain d2iolb_: 2iol B: [137574] automated match to d2iona1 |
PDB Entry: 2iol (more details), 2 Å
SCOPe Domain Sequences for d2iolb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iolb_ a.118.1.14 (B:) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]} qpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesafk mildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagiisk qlrdlcp
Timeline for d2iolb_: