Lineage for d2iolb1 (2iol B:322-448)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 646821Superfamily a.118.1: ARM repeat [48371] (22 families) (S)
  5. 646987Family a.118.1.14: MIF4G domain-like [100908] (5 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 647024Protein Programmed cell death 4, PDCD4 [140815] (1 species)
  7. 647025Species Mouse (Mus musculus) [TaxId:10090] [140816] (4 PDB entries)
  8. 647030Domain d2iolb1: 2iol B:322-448 [137574]
    automatically matched to 2IOL A:322-448

Details for d2iolb1

PDB Entry: 2iol (more details), 2 Å

PDB Description: Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form 1
PDB Compounds: (B:) Programmed Cell Death 4, Pdcd4

SCOP Domain Sequences for d2iolb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iolb1 a.118.1.14 (B:322-448) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]}
qpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesafk
mildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagiisk
qlrdlcp

SCOP Domain Coordinates for d2iolb1:

Click to download the PDB-style file with coordinates for d2iolb1.
(The format of our PDB-style files is described here.)

Timeline for d2iolb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2iola1