SCOP 1.73: Domain d2iolb1: 2iol B:322-448

Lineage for d2iolb1 (2iol B:322-448)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (22 families)

5. Family a.118.1.14: MIF4G domain-like [100908] (5 proteins)
   duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
   this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain

6. Protein Programmed cell death 4, PDCD4 [140815] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140816] (4 PDB entries)

8. Domain d2iolb1: 2iol B:322-448 [137574]
   automatically matched to 2IOL A:322-448

Details for d2iolb1

PDB Entry: 2iol, 2 Å

PDB Description: Crystal structure of the C-terminal MA3 domain of Pdcd4 (mouse); form 1

PDB Compounds: (B:) Programmed Cell Death 4, Pdcd4

SCOP Domain Sequences for d2iolb1:

Sequence; same for both SEQRES and ATOM records:

>d2iolb1 a.118.1.14 (B:322-448) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]}
qpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesafk
mildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagiisk
qlrdlcp

Timeline for d2iolb1:

• d2iolb1 is new in SCOP 1.73
  
• d2iolb1 appears in SCOP 1.75
  
• d2iolb1 appears in the current release, SCOPe 2.08, called d2iolb_