| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
| Family a.118.1.14: MIF4G domain-like [100908] (6 proteins) duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain |
| Protein Programmed cell death 4, PDCD4 [140815] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [140816] (5 PDB entries) Uniprot Q61823 322-448! Uniprot Q61823 322-450 |
| Domain d2iola1: 2iol A:322-448 [137573] 2nd MA3 domain applies to all domains of a family if the common domain is composed of a different number of small repeating units |
PDB Entry: 2iol (more details), 2 Å
SCOPe Domain Sequences for d2iola1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iola1 a.118.1.14 (A:322-448) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]}
qpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesafk
mildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagiisk
qlrdlcp
Timeline for d2iola1: