SCOP 1.73: Domain d2iobb2: 2iob B:13-200

Lineage for d2iobb2 (2iob B:13-200)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.15: CHAP domain [142870] (1 protein)
   Pfam PF05257

6. Protein Glutathionylspermidine synthase, amidase domain [142871] (1 species)

7. Species Escherichia coli [TaxId:562] [142872] (5 PDB entries)

8. Domain d2iobb2: 2iob B:13-200 [137571]
   Other proteins in same PDB: d2ioba1, d2ioba3, d2iobb1, d2iobb3
   automatically matched to 2IO7 A:10-200

Details for d2iobb2

PDB Entry: 2iob, 2.2 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Apo protein

PDB Compounds: (B:) Bifunctional glutathionylspermidine synthetase/amidase

SCOP Domain Sequences for d2iobb2:

Sequence; same for both SEQRES and ATOM records:

>d2iobb2 d.3.1.15 (B:13-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]}
gtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcvefarrflflnyg
vvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliwdkggefkdtghv
aiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiqt
edteyslp

Timeline for d2iobb2:

• d2iobb2 is new in SCOP 1.73
  
• d2iobb2 appears in SCOP 1.75
  
• d2iobb2 appears in the current release, SCOPe 2.08