![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.15: CHAP domain [142870] (1 protein) Pfam PF05257 |
![]() | Protein Glutathionylspermidine synthase, amidase domain [142871] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [142872] (5 PDB entries) Uniprot P0AES0 10-200 |
![]() | Domain d2iobb2: 2iob B:13-200 [137571] Other proteins in same PDB: d2ioba1, d2ioba3, d2iobb1, d2iobb3 automated match to d2io7a2 |
PDB Entry: 2iob (more details), 2.2 Å
SCOPe Domain Sequences for d2iobb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iobb2 d.3.1.15 (B:13-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]} gtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcvefarrflflnyg vvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliwdkggefkdtghv aiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiqt edteyslp
Timeline for d2iobb2: