Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.15: CHAP domain [142870] (1 protein) Pfam PF05257 |
Protein Glutathionylspermidine synthase, amidase domain [142871] (1 species) |
Species Escherichia coli [TaxId:562] [142872] (5 PDB entries) Uniprot P0AES0 10-200 |
Domain d2ioba2: 2iob A:12-200 [137568] Other proteins in same PDB: d2ioba1, d2ioba3, d2iobb1, d2iobb3 automated match to d2io7a2 |
PDB Entry: 2iob (more details), 2.2 Å
SCOPe Domain Sequences for d2ioba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ioba2 d.3.1.15 (A:12-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]} fgtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcvefarrflflny gvvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliwdkggefkdtgh vaiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiq tedteyslp
Timeline for d2ioba2: