Lineage for d2ioba2 (2iob A:12-200)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715176Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 715177Superfamily d.3.1: Cysteine proteinases [54001] (16 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 715642Family d.3.1.15: CHAP domain [142870] (1 protein)
    Pfam PF05257
  6. 715643Protein Glutathionylspermidine synthase, amidase domain [142871] (1 species)
  7. 715644Species Escherichia coli [TaxId:562] [142872] (5 PDB entries)
  8. 715649Domain d2ioba2: 2iob A:12-200 [137568]
    Other proteins in same PDB: d2ioba1, d2ioba3, d2iobb1, d2iobb3
    automatically matched to 2IO7 A:10-200

Details for d2ioba2

PDB Entry: 2iob (more details), 2.2 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Apo protein
PDB Compounds: (A:) Bifunctional glutathionylspermidine synthetase/amidase

SCOP Domain Sequences for d2ioba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ioba2 d.3.1.15 (A:12-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]}
fgtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcvefarrflflny
gvvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliwdkggefkdtgh
vaiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiq
tedteyslp

SCOP Domain Coordinates for d2ioba2:

Click to download the PDB-style file with coordinates for d2ioba2.
(The format of our PDB-style files is described here.)

Timeline for d2ioba2: