Lineage for d2ioba1 (2iob A:379-496)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470382Family c.30.1.7: Glutathionylspermidine synthase substrate-binding domain-like [142119] (1 protein)
    central part of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase
  6. 2470383Protein Glutathionylspermidine synthase, synthetase domain [142120] (1 species)
  7. 2470384Species Escherichia coli [TaxId:562] [142121] (5 PDB entries)
    Uniprot P0AES0 379-496
  8. 2470389Domain d2ioba1: 2iob A:379-496 [137567]
    Other proteins in same PDB: d2ioba2, d2ioba3, d2iobb2, d2iobb3
    automated match to d2io7a1

Details for d2ioba1

PDB Entry: 2iob (more details), 2.2 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Apo protein
PDB Compounds: (A:) Bifunctional glutathionylspermidine synthetase/amidase

SCOPe Domain Sequences for d2ioba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ioba1 c.30.1.7 (A:379-496) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}
rpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwdaagqlidgegrlvncv
wktwawetafdqirevsdrefaavpirtghpqnevrlidvllrpevlvfeplwtvipg

SCOPe Domain Coordinates for d2ioba1:

Click to download the PDB-style file with coordinates for d2ioba1.
(The format of our PDB-style files is described here.)

Timeline for d2ioba1: