SCOP 1.73: Domain d2ioba1: 2iob A:379-496

Lineage for d2ioba1 (2iob A:379-496)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (7 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.7: Glutathionylspermidine synthase substrate-binding domain-like [142119] (1 protein)
   central part of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase

6. Protein Glutathionylspermidine synthase, synthetase domain [142120] (1 species)

7. Species Escherichia coli [TaxId:562] [142121] (5 PDB entries)

8. Domain d2ioba1: 2iob A:379-496 [137567]
   Other proteins in same PDB: d2ioba2, d2ioba3, d2iobb2, d2iobb3
   automatically matched to 2IO7 A:379-496

Details for d2ioba1

PDB Entry: 2iob, 2.2 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Apo protein

PDB Compounds: (A:) Bifunctional glutathionylspermidine synthetase/amidase

SCOP Domain Sequences for d2ioba1:

Sequence; same for both SEQRES and ATOM records:

>d2ioba1 c.30.1.7 (A:379-496) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}
rpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwdaagqlidgegrlvncv
wktwawetafdqirevsdrefaavpirtghpqnevrlidvllrpevlvfeplwtvipg

Timeline for d2ioba1:

• d2ioba1 is new in SCOP 1.73
  
• d2ioba1 appears in SCOP 1.75
  
• d2ioba1 appears in the current release, SCOPe 2.08