Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (8 families) |
Family d.142.1.8: Glutathionylspermidine synthase ATP-binding domain-like [143890] (1 protein) both terminal parts of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase |
Protein Glutathionylspermidine synthase, synthetase domain [143891] (1 species) |
Species Escherichia coli [TaxId:562] [143892] (5 PDB entries) |
Domain d2ioab3: 2ioa B:201-378,B:497-615 [137566] Other proteins in same PDB: d2ioaa1, d2ioaa2, d2ioab1, d2ioab2 automatically matched to 2IO7 A:201-378,A:497-615 complexed with adp, gga, mg |
PDB Entry: 2ioa (more details), 2.8 Å
SCOP Domain Sequences for d2ioab3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ioab3 d.142.1.8 (B:201-378,B:497-615) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]} qpeiagellkisgarlenkgqfdgkwldekdplqnayvqangqvinqdpyhyytitesae qelikatnelhlmylhatdkvlkddnllalfdipkilwprlrlswqrrrhhmitgrmdfc mderglkvyeynadsaschteaglilerwaeqgykgngfnpaeglinelagawkhsraXn kailpilwslfphhrylldtdftvndelvktgyavkpiagrcgsnidlvshheevldkts gkfaeqkniyqqlwclpkvdgkyiqvctftvggnyggtclrgdeslvikkesdiepli
Timeline for d2ioab3: