SCOP 1.73: Domain d2ioab2: 2ioa B:12-200

Lineage for d2ioab2 (2ioa B:12-200)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.15: CHAP domain [142870] (1 protein)
   Pfam PF05257

6. Protein Glutathionylspermidine synthase, amidase domain [142871] (1 species)

7. Species Escherichia coli [TaxId:562] [142872] (5 PDB entries)

8. Domain d2ioab2: 2ioa B:12-200 [137565]
   Other proteins in same PDB: d2ioaa1, d2ioaa3, d2ioab1, d2ioab3
   automatically matched to 2IO7 A:10-200
   complexed with adp, gga, mg

Details for d2ioab2

PDB Entry: 2ioa, 2.8 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Incomplex with Mg2+ and ADP and phosphinate inhibitor

PDB Compounds: (B:) Bifunctional glutathionylspermidine synthetase/amidase

SCOP Domain Sequences for d2ioab2:

Sequence, based on SEQRES records:

>d2ioab2 d.3.1.15 (B:12-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]}
fgtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcvefarrflflny
gvvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliwdkggefkdtgh
vaiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiq
tedteyslp

Sequence, based on observed residues (ATOM records):

>d2ioab2 d.3.1.15 (B:12-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]}
fgtllgyapggvaiyssdysvfrsyiddeymghkwqcvefarrflflnygvvftdvgmaw
eifslrflrevvndnilplqafpngsprapvagalliwdkggefkdtghvaiitqlhgnk
vriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiqtedteyslp

Timeline for d2ioab2:

• d2ioab2 is new in SCOP 1.73
  
• d2ioab2 appears in SCOP 1.75
  
• d2ioab2 appears in the current release, SCOPe 2.08