Lineage for d2ioab1 (2ioa B:379-496)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 985731Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 985732Superfamily c.30.1: PreATP-grasp domain [52440] (8 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 985935Family c.30.1.7: Glutathionylspermidine synthase substrate-binding domain-like [142119] (1 protein)
    central part of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase
  6. 985936Protein Glutathionylspermidine synthase, synthetase domain [142120] (1 species)
  7. 985937Species Escherichia coli [TaxId:562] [142121] (5 PDB entries)
    Uniprot P0AES0 379-496
  8. 985945Domain d2ioab1: 2ioa B:379-496 [137564]
    Other proteins in same PDB: d2ioaa2, d2ioaa3, d2ioab2, d2ioab3
    automatically matched to 2IO7 A:379-496
    complexed with adp, gga, mg

Details for d2ioab1

PDB Entry: 2ioa (more details), 2.8 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Incomplex with Mg2+ and ADP and phosphinate inhibitor
PDB Compounds: (B:) Bifunctional glutathionylspermidine synthetase/amidase

SCOPe Domain Sequences for d2ioab1:

Sequence, based on SEQRES records: (download)

>d2ioab1 c.30.1.7 (B:379-496) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}
rpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwdaagqlidgegrlvncv
wktwawetafdqirevsdrefaavpirtghpqnevrlidvllrpevlvfeplwtvipg

Sequence, based on observed residues (ATOM records): (download)

>d2ioab1 c.30.1.7 (B:379-496) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}
rpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwgqlidgegrlvncvwkt
wawetafdqirevfaavpirtghpqnevrlidvllrpevlvfeplwtvipg

SCOPe Domain Coordinates for d2ioab1:

Click to download the PDB-style file with coordinates for d2ioab1.
(The format of our PDB-style files is described here.)

Timeline for d2ioab1: