| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) ![]() |
| Family d.142.1.8: Glutathionylspermidine synthase ATP-binding domain-like [143890] (1 protein) both terminal parts of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase |
| Protein Glutathionylspermidine synthase, synthetase domain [143891] (1 species) |
| Species Escherichia coli [TaxId:562] [143892] (5 PDB entries) Uniprot P0AES0 201-378,497-615 |
| Domain d2ioaa3: 2ioa A:201-378,A:497-618 [137563] Other proteins in same PDB: d2ioaa1, d2ioaa2, d2ioab1, d2ioab2 automated match to d2io7a3 complexed with adp, gga, mg |
PDB Entry: 2ioa (more details), 2.8 Å
SCOPe Domain Sequences for d2ioaa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ioaa3 d.142.1.8 (A:201-378,A:497-618) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}
qpeiagellkisgarlenkgqfdgkwldekdplqnayvqangqvinqdpyhyytitesae
qelikatnelhlmylhatdkvlkddnllalfdipkilwprlrlswqrrrhhmitgrmdfc
mderglkvyeynadsaschteaglilerwaeqgykgngfnpaeglinelagawkhsraXn
kailpilwslfphhrylldtdftvndelvktgyavkpiagrcgsnidlvshheevldkts
gkfaeqkniyqqlwclpkvdgkyiqvctftvggnyggtclrgdeslvikkesdieplivv
k
Timeline for d2ioaa3: