SCOP 1.73: Domain d2ioaa3: 2ioa A:201-378,A:497-615

Lineage for d2ioaa3 (2ioa A:201-378,A:497-615)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (8 families)

5. Family d.142.1.8: Glutathionylspermidine synthase ATP-binding domain-like [143890] (1 protein)
   both terminal parts of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase

6. Protein Glutathionylspermidine synthase, synthetase domain [143891] (1 species)

7. Species Escherichia coli [TaxId:562] [143892] (5 PDB entries)

8. Domain d2ioaa3: 2ioa A:201-378,A:497-615 [137563]
   Other proteins in same PDB: d2ioaa1, d2ioaa2, d2ioab1, d2ioab2
   automatically matched to 2IO7 A:201-378,A:497-615
   complexed with adp, gga, mg

Details for d2ioaa3

PDB Entry: 2ioa, 2.8 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Incomplex with Mg2+ and ADP and phosphinate inhibitor

PDB Compounds: (A:) Bifunctional glutathionylspermidine synthetase/amidase

SCOP Domain Sequences for d2ioaa3:

Sequence; same for both SEQRES and ATOM records:

>d2ioaa3 d.142.1.8 (A:201-378,A:497-615) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}
qpeiagellkisgarlenkgqfdgkwldekdplqnayvqangqvinqdpyhyytitesae
qelikatnelhlmylhatdkvlkddnllalfdipkilwprlrlswqrrrhhmitgrmdfc
mderglkvyeynadsaschteaglilerwaeqgykgngfnpaeglinelagawkhsraXn
kailpilwslfphhrylldtdftvndelvktgyavkpiagrcgsnidlvshheevldkts
gkfaeqkniyqqlwclpkvdgkyiqvctftvggnyggtclrgdeslvikkesdiepli

Timeline for d2ioaa3:

• d2ioaa3 is new in SCOP 1.73
  
• d2ioaa3 appears in SCOP 1.75
  
• d2ioaa3 appears in the current release, SCOPe 2.08