| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.7: Glutathionylspermidine synthase substrate-binding domain-like [142119] (1 protein) central part of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase |
| Protein Glutathionylspermidine synthase, synthetase domain [142120] (1 species) |
| Species Escherichia coli [TaxId:562] [142121] (5 PDB entries) Uniprot P0AES0 379-496 |
| Domain d2ioaa1: 2ioa A:379-496 [137561] Other proteins in same PDB: d2ioaa2, d2ioaa3, d2ioab2, d2ioab3 automated match to d2io7a1 complexed with adp, gga, mg |
PDB Entry: 2ioa (more details), 2.8 Å
SCOPe Domain Sequences for d2ioaa1:
Sequence, based on SEQRES records: (download)
>d2ioaa1 c.30.1.7 (A:379-496) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}
rpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwdaagqlidgegrlvncv
wktwawetafdqirevsdrefaavpirtghpqnevrlidvllrpevlvfeplwtvipg
>d2ioaa1 c.30.1.7 (A:379-496) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}
rpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwqlidgegrlvncvwktw
awetafdqirevfaavpirtghpqnevrlidvllrpevlvfeplwtvipg
Timeline for d2ioaa1: