SCOPe 2.08: Domain d2ioaa1: 2ioa A:379-496

Lineage for d2ioaa1 (2ioa A:379-496)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.7: Glutathionylspermidine synthase substrate-binding domain-like [142119] (1 protein)
   central part of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase

6. Protein Glutathionylspermidine synthase, synthetase domain [142120] (1 species)

7. Species Escherichia coli [TaxId:562] [142121] (5 PDB entries)
   Uniprot P0AES0 379-496

8. Domain d2ioaa1: 2ioa A:379-496 [137561]
   Other proteins in same PDB: d2ioaa2, d2ioaa3, d2ioab2, d2ioab3
   automated match to d2io7a1
   complexed with adp, gga, mg

Details for d2ioaa1

PDB Entry: 2ioa, 2.8 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Incomplex with Mg2+ and ADP and phosphinate inhibitor

PDB Compounds: (A:) Bifunctional glutathionylspermidine synthetase/amidase

SCOPe Domain Sequences for d2ioaa1:

Sequence, based on SEQRES records:

>d2ioaa1 c.30.1.7 (A:379-496) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}
rpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwdaagqlidgegrlvncv
wktwawetafdqirevsdrefaavpirtghpqnevrlidvllrpevlvfeplwtvipg

Sequence, based on observed residues (ATOM records):

>d2ioaa1 c.30.1.7 (A:379-496) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}
rpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwqlidgegrlvncvwktw
awetafdqirevfaavpirtghpqnevrlidvllrpevlvfeplwtvipg

Timeline for d2ioaa1:

• d2ioaa1 first appeared in SCOP 1.73
  
• d2ioaa1 appears in SCOPe 2.07