Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.8: Glutathionylspermidine synthase ATP-binding domain-like [143890] (1 protein) both terminal parts of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase |
Protein Glutathionylspermidine synthase, synthetase domain [143891] (1 species) |
Species Escherichia coli [TaxId:562] [143892] (5 PDB entries) Uniprot P0AES0 201-378,497-615 |
Domain d2io9b3: 2io9 B:201-378,B:497-618 [137560] Other proteins in same PDB: d2io9a1, d2io9a2, d2io9b1, d2io9b2 automated match to d2io7a3 complexed with adp, gsh, mg |
PDB Entry: 2io9 (more details), 2.2 Å
SCOPe Domain Sequences for d2io9b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2io9b3 d.142.1.8 (B:201-378,B:497-618) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]} qpeiagellkisgarlenkgqfdgkwldekdplqnayvqangqvinqdpyhyytitesae qelikatnelhlmylhatdkvlkddnllalfdipkilwprlrlswqrrrhhmitgrmdfc mderglkvyeynadsaschteaglilerwaeqgykgngfnpaeglinelagawkhsraXn kailpilwslfphhrylldtdftvndelvktgyavkpiagrcgsnidlvshheevldkts gkfaeqkniyqqlwclpkvdgkyiqvctftvggnyggtclrgdeslvikkesdieplivv k
Timeline for d2io9b3: