Lineage for d2io9b3 (2io9 B:201-378,B:497-615)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734347Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 734348Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (8 families) (S)
  5. 734578Family d.142.1.8: Glutathionylspermidine synthase ATP-binding domain-like [143890] (1 protein)
    both terminal parts of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase
  6. 734579Protein Glutathionylspermidine synthase, synthetase domain [143891] (1 species)
  7. 734580Species Escherichia coli [TaxId:562] [143892] (5 PDB entries)
  8. 734584Domain d2io9b3: 2io9 B:201-378,B:497-615 [137560]
    Other proteins in same PDB: d2io9a1, d2io9a2, d2io9b1, d2io9b2
    automatically matched to 2IO7 A:201-378,A:497-615
    complexed with adp, gsh, mg

Details for d2io9b3

PDB Entry: 2io9 (more details), 2.2 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Incomplex with Mg2+ ,GSH and ADP
PDB Compounds: (B:) Bifunctional glutathionylspermidine synthetase/amidase

SCOP Domain Sequences for d2io9b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io9b3 d.142.1.8 (B:201-378,B:497-615) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}
qpeiagellkisgarlenkgqfdgkwldekdplqnayvqangqvinqdpyhyytitesae
qelikatnelhlmylhatdkvlkddnllalfdipkilwprlrlswqrrrhhmitgrmdfc
mderglkvyeynadsaschteaglilerwaeqgykgngfnpaeglinelagawkhsraXn
kailpilwslfphhrylldtdftvndelvktgyavkpiagrcgsnidlvshheevldkts
gkfaeqkniyqqlwclpkvdgkyiqvctftvggnyggtclrgdeslvikkesdiepli

SCOP Domain Coordinates for d2io9b3:

Click to download the PDB-style file with coordinates for d2io9b3.
(The format of our PDB-style files is described here.)

Timeline for d2io9b3: