![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (7 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.7: Glutathionylspermidine synthase substrate-binding domain-like [142119] (1 protein) central part of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase |
![]() | Protein Glutathionylspermidine synthase, synthetase domain [142120] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [142121] (5 PDB entries) |
![]() | Domain d2io9b1: 2io9 B:379-496 [137558] Other proteins in same PDB: d2io9a2, d2io9a3, d2io9b2, d2io9b3 automatically matched to 2IO7 A:379-496 complexed with adp, gsh, mg |
PDB Entry: 2io9 (more details), 2.2 Å
SCOP Domain Sequences for d2io9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2io9b1 c.30.1.7 (B:379-496) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]} rpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwdaagqlidgegrlvncv wktwawetafdqirevsdrefaavpirtghpqnevrlidvllrpevlvfeplwtvipg
Timeline for d2io9b1: