Lineage for d2io9b1 (2io9 B:379-496)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694027Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 694028Superfamily c.30.1: PreATP-grasp domain [52440] (7 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 694223Family c.30.1.7: Glutathionylspermidine synthase substrate-binding domain-like [142119] (1 protein)
    central part of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase
  6. 694224Protein Glutathionylspermidine synthase, synthetase domain [142120] (1 species)
  7. 694225Species Escherichia coli [TaxId:562] [142121] (5 PDB entries)
  8. 694229Domain d2io9b1: 2io9 B:379-496 [137558]
    Other proteins in same PDB: d2io9a2, d2io9a3, d2io9b2, d2io9b3
    automatically matched to 2IO7 A:379-496
    complexed with adp, gsh, mg

Details for d2io9b1

PDB Entry: 2io9 (more details), 2.2 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Incomplex with Mg2+ ,GSH and ADP
PDB Compounds: (B:) Bifunctional glutathionylspermidine synthetase/amidase

SCOP Domain Sequences for d2io9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io9b1 c.30.1.7 (B:379-496) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}
rpfvhimqdkdieenyhaqfmeqalhqagfetrilrgldelgwdaagqlidgegrlvncv
wktwawetafdqirevsdrefaavpirtghpqnevrlidvllrpevlvfeplwtvipg

SCOP Domain Coordinates for d2io9b1:

Click to download the PDB-style file with coordinates for d2io9b1.
(The format of our PDB-style files is described here.)

Timeline for d2io9b1: