Lineage for d2io9a3 (2io9 A:201-378,A:497-618)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. Family d.142.1.8: Glutathionylspermidine synthase ATP-binding domain-like [143890] (1 protein)
    both terminal parts of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase
  6. Protein Glutathionylspermidine synthase, synthetase domain [143891] (1 species)
  7. Species Escherichia coli [TaxId:562] [143892] (5 PDB entries)
    Uniprot P0AES0 201-378,497-615
  8. Domain d2io9a3: 2io9 A:201-378,A:497-618 [137557]
    Other proteins in same PDB: d2io9a1, d2io9a2, d2io9b1, d2io9b2
    automated match to d2io7a3
    complexed with adp, gsh, mg

Details for d2io9a3

PDB Entry: 2io9 (more details), 2.2 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Incomplex with Mg2+ ,GSH and ADP
PDB Compounds: (A:) Bifunctional glutathionylspermidine synthetase/amidase

SCOPe Domain Sequences for d2io9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io9a3 d.142.1.8 (A:201-378,A:497-618) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}
qpeiagellkisgarlenkgqfdgkwldekdplqnayvqangqvinqdpyhyytitesae
qelikatnelhlmylhatdkvlkddnllalfdipkilwprlrlswqrrrhhmitgrmdfc
mderglkvyeynadsaschteaglilerwaeqgykgngfnpaeglinelagawkhsraXn
kailpilwslfphhrylldtdftvndelvktgyavkpiagrcgsnidlvshheevldkts
gkfaeqkniyqqlwclpkvdgkyiqvctftvggnyggtclrgdeslvikkesdieplivv
k

SCOPe Domain Coordinates for d2io9a3 are not available.

Timeline for d2io9a3:

Domains from same chain:
(mouse over for more information)
d2io9a1, d2io9a2
Domains from other chains:
(mouse over for more information)
d2io9b1, d2io9b2, d2io9b3