![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (8 families) ![]() |
![]() | Family d.142.1.8: Glutathionylspermidine synthase ATP-binding domain-like [143890] (1 protein) both terminal parts of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase |
![]() | Protein Glutathionylspermidine synthase, synthetase domain [143891] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [143892] (5 PDB entries) |
![]() | Domain d2io8b3: 2io8 B:201-378,B:497-615 [137554] Other proteins in same PDB: d2io8a1, d2io8a2, d2io8b1, d2io8b2 automatically matched to 2IO7 A:201-378,A:497-615 complexed with adp, cys, mg |
PDB Entry: 2io8 (more details), 2.1 Å
SCOP Domain Sequences for d2io8b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2io8b3 d.142.1.8 (B:201-378,B:497-615) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]} qpeiagellkisgarlenkgqfdgkwldekdplqnayvqangqvinqdpyhyytitesae qelikatnelhlmylhatdkvlkddnllalfdipkilwprlrlswqrrrhhmitgrmdfc mderglkvyeynadsaschteaglilerwaeqgykgngfnpaeglinelagawkhsraXn kailpilwslfphhrylldtdftvndelvktgyavkpiagrcgsnidlvshheevldkts gkfaeqkniyqqlwclpkvdgkyiqvctftvggnyggtclrgdeslvikkesdiepli
Timeline for d2io8b3: