Lineage for d2io8b3 (2io8 B:201-378,B:497-618)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541682Family d.142.1.8: Glutathionylspermidine synthase ATP-binding domain-like [143890] (1 protein)
    both terminal parts of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase
  6. 2541683Protein Glutathionylspermidine synthase, synthetase domain [143891] (1 species)
  7. 2541684Species Escherichia coli [TaxId:562] [143892] (5 PDB entries)
    Uniprot P0AES0 201-378,497-615
  8. 2541686Domain d2io8b3: 2io8 B:201-378,B:497-618 [137554]
    Other proteins in same PDB: d2io8a1, d2io8a2, d2io8b1, d2io8b2
    automated match to d2io7a3
    complexed with adp, cys, mg

Details for d2io8b3

PDB Entry: 2io8 (more details), 2.1 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Incomplex with Mg2+ and ADP
PDB Compounds: (B:) Bifunctional glutathionylspermidine synthetase/amidase

SCOPe Domain Sequences for d2io8b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io8b3 d.142.1.8 (B:201-378,B:497-618) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}
qpeiagellkisgarlenkgqfdgkwldekdplqnayvqangqvinqdpyhyytitesae
qelikatnelhlmylhatdkvlkddnllalfdipkilwprlrlswqrrrhhmitgrmdfc
mderglkvyeynadsaschteaglilerwaeqgykgngfnpaeglinelagawkhsraXn
kailpilwslfphhrylldtdftvndelvktgyavkpiagrcgsnidlvshheevldkts
gkfaeqkniyqqlwclpkvdgkyiqvctftvggnyggtclrgdeslvikkesdieplivv
k

SCOPe Domain Coordinates for d2io8b3:

Click to download the PDB-style file with coordinates for d2io8b3.
(The format of our PDB-style files is described here.)

Timeline for d2io8b3: