Lineage for d2io8a2 (2io8 A:10-200)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2173267Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2173268Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2174065Family d.3.1.15: CHAP domain [142870] (1 protein)
    Pfam PF05257
  6. 2174066Protein Glutathionylspermidine synthase, amidase domain [142871] (1 species)
  7. 2174067Species Escherichia coli [TaxId:562] [142872] (5 PDB entries)
    Uniprot P0AES0 10-200
  8. 2174068Domain d2io8a2: 2io8 A:10-200 [137550]
    Other proteins in same PDB: d2io8a1, d2io8a3, d2io8b1, d2io8b3
    automated match to d2io7a2
    complexed with adp, cys, mg

Details for d2io8a2

PDB Entry: 2io8 (more details), 2.1 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Incomplex with Mg2+ and ADP
PDB Compounds: (A:) Bifunctional glutathionylspermidine synthetase/amidase

SCOPe Domain Sequences for d2io8a2:

Sequence, based on SEQRES records: (download)

>d2io8a2 d.3.1.15 (A:10-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]}
apfgtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcvefarrflfl
nygvvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliwdkggefkdt
ghvaiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwm
iqtedteyslp

Sequence, based on observed residues (ATOM records): (download)

>d2io8a2 d.3.1.15 (A:10-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]}
apfgtllgyapggvaiyssdysddavfrsyiddeymghkwqcvefarrflflnygvvftd
vgmaweifslrflrevvndnilplqafpngsprapvagalliwdkggefkdtghvaiitq
lhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiqtedtey
slp

SCOPe Domain Coordinates for d2io8a2:

Click to download the PDB-style file with coordinates for d2io8a2.
(The format of our PDB-style files is described here.)

Timeline for d2io8a2: