Lineage for d2io7b2 (2io7 B:12-200)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1191813Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1191814Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1192439Family d.3.1.15: CHAP domain [142870] (1 protein)
    Pfam PF05257
  6. 1192440Protein Glutathionylspermidine synthase, amidase domain [142871] (1 species)
  7. 1192441Species Escherichia coli [TaxId:562] [142872] (5 PDB entries)
    Uniprot P0AES0 10-200
  8. 1192451Domain d2io7b2: 2io7 B:12-200 [137547]
    Other proteins in same PDB: d2io7a1, d2io7a3, d2io7b1, d2io7b3
    automatically matched to 2IO7 A:10-200
    complexed with anp, mg

Details for d2io7b2

PDB Entry: 2io7 (more details), 2.7 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Incomplex with Mg2+ and AMPPNP
PDB Compounds: (B:) Bifunctional glutathionylspermidine synthetase/amidase

SCOPe Domain Sequences for d2io7b2:

Sequence, based on SEQRES records: (download)

>d2io7b2 d.3.1.15 (B:12-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]}
fgtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcvefarrflflny
gvvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliwdkggefkdtgh
vaiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiq
tedteyslp

Sequence, based on observed residues (ATOM records): (download)

>d2io7b2 d.3.1.15 (B:12-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]}
fgtllgyapggvaiysavfrsyiddeymghkwqcvefarrflflnygvvftdvgmaweif
slrflrevvndnilplqafpngsprapvagalliwdkggefkdtghvaiitqlhgnkvri
aeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiqtedteyslp

SCOPe Domain Coordinates for d2io7b2:

Click to download the PDB-style file with coordinates for d2io7b2.
(The format of our PDB-style files is described here.)

Timeline for d2io7b2: