Lineage for d2io7a3 (2io7 A:201-378,A:497-615)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219586Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1219587Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) (S)
  5. 1219838Family d.142.1.8: Glutathionylspermidine synthase ATP-binding domain-like [143890] (1 protein)
    both terminal parts of Pfam PF03738; GSP; overal similarity of the Pfam domain to the Eukaryotic glutathione synthetase
  6. 1219839Protein Glutathionylspermidine synthase, synthetase domain [143891] (1 species)
  7. 1219840Species Escherichia coli [TaxId:562] [143892] (5 PDB entries)
    Uniprot P0AES0 201-378,497-615
  8. 1219849Domain d2io7a3: 2io7 A:201-378,A:497-615 [137545]
    Other proteins in same PDB: d2io7a1, d2io7a2, d2io7b1, d2io7b2
    complexed with anp, mg

Details for d2io7a3

PDB Entry: 2io7 (more details), 2.7 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Incomplex with Mg2+ and AMPPNP
PDB Compounds: (A:) Bifunctional glutathionylspermidine synthetase/amidase

SCOPe Domain Sequences for d2io7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io7a3 d.142.1.8 (A:201-378,A:497-615) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}
qpeiagellkisgarlenkgqfdgkwldekdplqnayvqangqvinqdpyhyytitesae
qelikatnelhlmylhatdkvlkddnllalfdipkilwprlrlswqrrrhhmitgrmdfc
mderglkvyeynadsaschteaglilerwaeqgykgngfnpaeglinelagawkhsraXn
kailpilwslfphhrylldtdftvndelvktgyavkpiagrcgsnidlvshheevldkts
gkfaeqkniyqqlwclpkvdgkyiqvctftvggnyggtclrgdeslvikkesdiepli

SCOPe Domain Coordinates for d2io7a3:

Click to download the PDB-style file with coordinates for d2io7a3.
(The format of our PDB-style files is described here.)

Timeline for d2io7a3: