Lineage for d2io7a2 (2io7 A:10-200)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1889705Family d.3.1.15: CHAP domain [142870] (1 protein)
    Pfam PF05257
  6. 1889706Protein Glutathionylspermidine synthase, amidase domain [142871] (1 species)
  7. 1889707Species Escherichia coli [TaxId:562] [142872] (5 PDB entries)
    Uniprot P0AES0 10-200
  8. 1889716Domain d2io7a2: 2io7 A:10-200 [137544]
    Other proteins in same PDB: d2io7a1, d2io7a3, d2io7b1, d2io7b3
    complexed with anp, mg

Details for d2io7a2

PDB Entry: 2io7 (more details), 2.7 Å

PDB Description: E. coli Bifunctional glutathionylspermidine synthetase/amidase Incomplex with Mg2+ and AMPPNP
PDB Compounds: (A:) Bifunctional glutathionylspermidine synthetase/amidase

SCOPe Domain Sequences for d2io7a2:

Sequence, based on SEQRES records: (download)

>d2io7a2 d.3.1.15 (A:10-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]}
apfgtllgyapggvaiyssdyssldpqeyeddavfrsyiddeymghkwqcvefarrflfl
nygvvftdvgmaweifslrflrevvndnilplqafpngsprapvagalliwdkggefkdt
ghvaiitqlhgnkvriaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwm
iqtedteyslp

Sequence, based on observed residues (ATOM records): (download)

>d2io7a2 d.3.1.15 (A:10-200) Glutathionylspermidine synthase, amidase domain {Escherichia coli [TaxId: 562]}
apfgtllgyapggvaiyssdyrsyiddeymghkwqcvefarrflflnygvvftdvgmawe
ifslrflrevvndnilplqafpngsprapvagalliwdkggefkdtghvaiitqlhgnkv
riaeqnvihsplpqgqqwtrelemvvengcytlkdtfddttilgwmiqtedteyslp

SCOPe Domain Coordinates for d2io7a2:

Click to download the PDB-style file with coordinates for d2io7a2.
(The format of our PDB-style files is described here.)

Timeline for d2io7a2: